MX dataset details
Additional information Native
Dataset Raw data for B7_1
MX dataset details
Additional information Zn anomalous
Dataset Raw data for C7_Znlow_1
MX dataset details
Additional information Zn anomalous
Dataset Raw data for C7_Znhigh_1
MX dataset details
Additional information Ni anomalous
Dataset Raw data for B7_3
MX dataset details
Additional information Ni anomalous
Dataset Raw data for B7_2
Protein Data Bank
PDB ID 4MTQ
R-Free 0.2329
R-Value 0.1853 (obs.)
Resolution 2.17 Å
Space Group P 21 21 21
Title Ni-bound GloA2
Unit Cell (Å,°) (a = 41.145, b = 74.983, c = 80.362),(alpha = 90.00, beta = 90.00, gamma = 90.00)
URL http://www.pdb.org/pdb/search/structidSearch.do?structureId=4MTQ
Experiment ID
EPN 3051
Beamline MX2
Experiment ID
EPN 3375a
Beamline MX2
Publication Details
Acknowledgements This research was undertaken on the MX2 beamline at the Australian Synchrotron, Victoria, Australia.
DOI 10.4225/52/563BD46765F73
Sequence Data
Expression System Escherichia coli
Organism Pseudomonas aeruginosa
Sequence MRILHSMLRVADLEAALEFYTRALDMRLLRRRDYPEGRFTLAFVGYQDERAAAALELTHNWDRDGYTQGDGYGHLAIEVE DAAVTCARARALGYRVTREAGLMQHGRSVIAFLEDPDGYKVELIQKGTQFD
Citation
Authors Bythell-Douglas, R.; Suttisansanee, U.; Flematti, G.R.; Challenor, M.; Lee, M.; Panjikar, S.; Honek, J.F.; Bond, C.S.
DOI http://dx.doi.org/10.1002/chem.201405402
Journal Chemistry
Pages 541-544
Title The crystal structure of a homodimeric Pseudomonas glyoxalase I enzyme reveals asymmetric metallation commensurate with half-of-sites activity.
Volume 21