MX dataset details
Additional information Anomalous
Dataset Raw data for C4_Ni_low_1
MX dataset details
Additional information Anomalous
Dataset Raw data for C4_Ni_low_0
MX dataset details
Additional information Anomalous
Dataset Raw data for C4_Ni_high_1
MX dataset details
Additional information Anomalous
Dataset Raw data for C4_Ni_high_0
MX dataset details
Additional information Anomalous
Dataset Raw data for C4_Zn_low_1
MX dataset details
Additional information Anomalous
Dataset Raw data for C4_Zn_low_0
MX dataset details
Additional information Anomalous
Dataset Raw data for C4_Zn_high_1
MX dataset details
Additional information Anomalous
Dataset Raw data for C4_Zn_high_0
MX dataset details
Dataset Raw data for C4_native_1
MX dataset details
Additional information
Dataset Raw data for C4_native_0
Protein Data Bank
PDB ID 4MTT
Resolution 2.17 Å
R-Free 0.2348
R-Value 0.1771 (obs.)
Space Group P 65 2 2
Title Ni- and Zn-bound GloA2 at low resolution
Unit Cell (Å,°) (a = 51.070, b = 51.070, c = 327.630),(alpha = 90.00, beta = 90.00, gamma = 120.00)
URL http://www.pdb.org/pdb/search/structidSearch.do?structureId=4MTT
MX dataset details
Additional information Native
Dataset Raw data for B8_1
Experiment ID
Beamline MX2
EPN 3375a
Experiment ID
Beamline MX1
EPN 4207
Publication Details
Acknowledgements This research was undertaken on the MX1 and MX2 beamlines at the Australian Synchrotron, Victoria, Australia.
DOI 10.4225/52/5639A2941B57F
Sequence Data
Expression System Escherichia coli
Organism Pseudomonas aeruginosa
Sequence MRILHSMLRVADLEAALEFYTRALDMRLLRRRDYPEGRFTLAFVGYQDERAAAALELTHNWDRDGYTQGDGYGHLAIEVE DAAVTCARARALGYRVTREAGLMQHGRSVIAFLEDPDGYKVELIQKGTQFD
Citation
Authors Bythell-Douglas, R.; Suttisansanee, U.; Flematti, G.R.; Challenor, M.; Lee, M.; Panjikar, S.; Honek, J.F.; Bond, C.S.
DOI http://dx.doi.org/10.1002/chem.201405402
Journal Chemistry
Pages 541-544
Title The crystal structure of a homodimeric Pseudomonas glyoxalase I enzyme reveals asymmetric metallation commensurate with half-of-sites activity.
Volume 21