Protein Data Bank
PDB ID 3W56
URL http://pdb.org/pdb/search/structidSearch.do?structureId=3W56
Organism Scophthalmus maximus
Expression System Escherichia coli
Sequence >3W56:A|PDBID|CHAIN|SEQUENCE MRGSHHHHHHENLYFQGQNSHMQLRLYNLRVRGLPSDLMGITDGYVKVFCGSANLGETSVNHNNANPWWTEEFSHFKAQE NDILRLEVHDEDTFFDDLLGVCQRQIKVGTHEHDCYLKEGGTLHYMYTLSV
Resolution 1.6 Å
R-Value 0.214 (obs.)
R-Free 0.251
Space Group I 1 2 1
Unit Cell (Å,°) (a = 25.35, b = 55.22, c = 89.75),(a = 90.00, b = 91.17, c = 90.00)
Experiment ID
EPN 4297
Beamline MX2