Protein Data Bank
PDB ID 4BOF
URL http://www.rcsb.org/pdb/explore/explore.do?structureId=4BOF
Organism Streptococcus pyogenes
Expression System Escherichia coli
Sequence >4BOF:D|PDBID|CHAIN|SEQUENCE MTAQTPIHVYSEIGKLKKVLLHRPGKEIENLMPDYLERLLFDDIPFLEDAQKEHDAFAQALRDEGIEVLYLETLAAESLV TPEIREAFIDEYLSEANIRGRATKKAIRELLMAIEDNQELIEKTMAGVQKSELPEIPASEKGLTDLVESNYPFAIDPMPN LYFTRDPFATIGTGVSLNHMFSETRNRETLYGKYIFTHHPIYGGGKVPMVYDRNETTRIEGGDELVLSKDVLAVGISQRT DAASIEKLLVNIFKQNLGFKKVLAFEFANNRKFMHLDTVFTMVDYDKFTIHPEIEGDLRVYSVTYDNEELHIVEEKGDLA ELLAANLGVEKVDLIRCGGDNLVAAGREQWNDGSNTLTIAPGVVVVYNRNTITNAILESKGLKLIKIHGSELVRGRGGPR CMSMPFEREDI
Resolution 2.48 Å
R-Value 0.213 (obs.)
R-Free 0.244
Space Group P 1
Unit Cell (Å,°) (a = 87.91, b = 92.74, c = 120.97),(a = 96.15, b = 90.27, c = 100.13)
Experiment ID
EPN 4014c
Beamline MX1